SCOPe 2.08: Domain d2az4a1: 2az4 A:56-238

Lineage for d2az4a1 (2az4 A:56-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins)
   contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif

6. Protein Hypothetical protein EF2904 [143928] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [143929] (1 PDB entry)
   Uniprot Q82ZZ3 5-429

8. Domain d2az4a1: 2az4 A:56-238 [127597]
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2az4a1

PDB Entry: 2az4, 2 Å

PDB Description: crystal structure of a protein of unknown function from enterococcus faecalis v583

PDB Compounds: (A:) hypothetical protein EF2904

SCOPe Domain Sequences for d2az4a1:

Sequence; same for both SEQRES and ATOM records:

>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]}
nnrlvpelkdlydprlgyeyhgaedkdyqhtavflshahldhsrminyldpavplytlke
tkmilnslnrkgdflipspfeeknftremiglnkndvikvgeisveivpvdhdaygasal
lirtpdhfitytgdlrlhghnreetlafcekakhtellmmegvsisfperepdpaqiavv
see

Timeline for d2az4a1:

• d2az4a1 first appeared in SCOP 1.73
  
• d2az4a1 appears in SCOPe 2.07