Lineage for d2az3i1 (2az3 I:5-155)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724085Species Archaeon Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
  8. 724094Domain d2az3i1: 2az3 I:5-155 [127596]
    automatically matched to 2AZ1 A:4-158
    complexed with cdp, mg

Details for d2az3i1

PDB Entry: 2az3 (more details), 2.2 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum in complex with cdp
PDB Compounds: (I:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2az3i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az3i1 d.58.6.1 (I:5-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]}
dertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffdg
lvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhe
deganereialffdddelvdwdrdasawvye

SCOP Domain Coordinates for d2az3i1:

Click to download the PDB-style file with coordinates for d2az3i1.
(The format of our PDB-style files is described here.)

Timeline for d2az3i1: