| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
| Species Archaeon Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries) |
| Domain d2az3i1: 2az3 I:5-155 [127596] automatically matched to 2AZ1 A:4-158 complexed with cdp, mg |
PDB Entry: 2az3 (more details), 2.2 Å
SCOP Domain Sequences for d2az3i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az3i1 d.58.6.1 (I:5-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]}
dertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffdg
lvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhe
deganereialffdddelvdwdrdasawvye
Timeline for d2az3i1: