Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Archaeon Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries) |
Domain d2az3f1: 2az3 F:4-155 [127593] automatically matched to 2AZ1 A:4-158 complexed with cdp, mg |
PDB Entry: 2az3 (more details), 2.2 Å
SCOP Domain Sequences for d2az3f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az3f1 d.58.6.1 (F:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh edeganereialffdddelvdwdrdasawvye
Timeline for d2az3f1: