Lineage for d2az3c1 (2az3 C:4-156)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 861823Species Archaeon Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
    Uniprot P61136 4-158
  8. 861826Domain d2az3c1: 2az3 C:4-156 [127590]
    automatically matched to 2AZ1 A:4-158
    complexed with cdp, mg

Details for d2az3c1

PDB Entry: 2az3 (more details), 2.2 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum in complex with cdp
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2az3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az3c1 d.58.6.1 (C:4-156) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]}
hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
edeganereialffdddelvdwdrdasawvyed

SCOP Domain Coordinates for d2az3c1:

Click to download the PDB-style file with coordinates for d2az3c1.
(The format of our PDB-style files is described here.)

Timeline for d2az3c1: