Lineage for d2az2b_ (2az2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995547Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) (S)
    automatically mapped to Pfam PF11473
  5. 1995548Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)
  6. 1995549Protein B2 [140508] (1 species)
  7. 1995550Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
    Uniprot P68831 1-72! Uniprot P68831 2-71
  8. 1995554Domain d2az2b_: 2az2 B: [127587]
    automated match to d2b9za1
    protein/RNA complex

Details for d2az2b_

PDB Entry: 2az2 (more details), 2.6 Å

PDB Description: Flock House virus B2-dsRNA Complex (P4122)
PDB Compounds: (B:) B2 protein

SCOPe Domain Sequences for d2az2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az2b_ a.30.8.1 (B:) B2 {Flock house virus, FHV [TaxId: 12287]}
psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
kpsvvayleg

SCOPe Domain Coordinates for d2az2b_:

Click to download the PDB-style file with coordinates for d2az2b_.
(The format of our PDB-style files is described here.)

Timeline for d2az2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2az2a_