![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) ![]() |
![]() | Family a.30.8.1: FHV B2 protein-like [140507] (1 protein) |
![]() | Protein B2 [140508] (1 species) |
![]() | Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries) Uniprot P68831 1-72! Uniprot P68831 2-71 |
![]() | Domain d2az2b_: 2az2 B: [127587] automated match to d2b9za1 protein/RNA complex |
PDB Entry: 2az2 (more details), 2.6 Å
SCOPe Domain Sequences for d2az2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az2b_ a.30.8.1 (B:) B2 {Flock house virus, FHV [TaxId: 12287]} psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle kpsvvayleg
Timeline for d2az2b_: