SCOPe 2.08: Domain d2az2b_: 2az2 B:

Lineage for d2az2b_ (2az2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.8: FHV B2 protein-like [140506] (1 family)
   automatically mapped to Pfam PF11473

5. Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)

6. Protein B2 [140508] (1 species)

7. Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
   Uniprot P68831 1-72! Uniprot P68831 2-71

8. Domain d2az2b_: 2az2 B: [127587]
   automated match to d2b9za1
   protein/RNA complex

Details for d2az2b_

PDB Entry: 2az2, 2.6 Å

PDB Description: Flock House virus B2-dsRNA Complex (P4122)

PDB Compounds: (B:) B2 protein

SCOPe Domain Sequences for d2az2b_:

Sequence; same for both SEQRES and ATOM records:

>d2az2b_ a.30.8.1 (B:) B2 {Flock house virus, FHV [TaxId: 12287]}
psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
kpsvvayleg

Timeline for d2az2b_:

• d2az2b_ first appeared in SCOP 1.73, called d2az2b1
  
• d2az2b_ appears in SCOPe 2.07