Lineage for d2az2a_ (2az2 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913370Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 913462Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) (S)
  5. 913463Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)
  6. 913464Protein B2 [140508] (1 species)
  7. 913465Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
    Uniprot P68831 1-72! Uniprot P68831 2-71
  8. 913468Domain d2az2a_: 2az2 A: [127586]
    automated match to d2b9za1
    protein/RNA complex

Details for d2az2a_

PDB Entry: 2az2 (more details), 2.6 Å

PDB Description: Flock House virus B2-dsRNA Complex (P4122)
PDB Compounds: (A:) B2 protein

SCOPe Domain Sequences for d2az2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az2a_ a.30.8.1 (A:) B2 {Flock house virus, FHV [TaxId: 12287]}
psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
kpsvvayleg

SCOPe Domain Coordinates for d2az2a_:

Click to download the PDB-style file with coordinates for d2az2a_.
(The format of our PDB-style files is described here.)

Timeline for d2az2a_:

913468
d2az2a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2az2b_