Lineage for d2az2a1 (2az2 A:2-71)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640053Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 640135Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) (S)
  5. 640136Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)
  6. 640137Protein B2 [140508] (1 species)
  7. 640138Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
  8. 640141Domain d2az2a1: 2az2 A:2-71 [127586]
    automatically matched to 2AZ0 A:2-71
    complexed with 5bu

Details for d2az2a1

PDB Entry: 2az2 (more details), 2.6 Å

PDB Description: Flock House virus B2-dsRNA Complex (P4122)
PDB Compounds: (A:) B2 protein

SCOP Domain Sequences for d2az2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az2a1 a.30.8.1 (A:2-71) B2 {Flock house virus, FHV [TaxId: 12287]}
psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
kpsvvayleg

SCOP Domain Coordinates for d2az2a1:

Click to download the PDB-style file with coordinates for d2az2a1.
(The format of our PDB-style files is described here.)

Timeline for d2az2a1: