Lineage for d2az1f_ (2az1 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951111Species Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
    Uniprot P61136 4-158
  8. 2951126Domain d2az1f_: 2az1 F: [127585]
    automated match to d2az1a1
    complexed with ca

Details for d2az1f_

PDB Entry: 2az1 (more details), 2.35 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2az1f_:

Sequence, based on SEQRES records: (download)

>d2az1f_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]}
dhdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpff
dglvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsd
hedeganereialffdddelvdwdrdasawvyedla

Sequence, based on observed residues (ATOM records): (download)

>d2az1f_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]}
dhdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehfdglvs
fitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhedeg
anereialffdddelvdwdrdasawvyedla

SCOPe Domain Coordinates for d2az1f_:

Click to download the PDB-style file with coordinates for d2az1f_.
(The format of our PDB-style files is described here.)

Timeline for d2az1f_: