Lineage for d2aywa1 (2ayw A:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671095Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)
  8. 671097Domain d2aywa1: 2ayw A:16-245 [127573]
    automatically matched to d1tgsz_
    complexed with ben, ca, gol, mes, ono

Details for d2aywa1

PDB Entry: 2ayw (more details), 0.97 Å

PDB Description: crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
PDB Compounds: (A:) cationic trypsin

SCOP Domain Sequences for d2aywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aywa1 b.47.1.2 (A:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d2aywa1:

Click to download the PDB-style file with coordinates for d2aywa1.
(The format of our PDB-style files is described here.)

Timeline for d2aywa1: