SCOPe 2.08: Domain d2aywa_: 2ayw A:

Lineage for d2aywa_ (2ayw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d2aywa_: 2ayw A: [127573]
   automated match to d1aq7__
   complexed with ben, ca, gol, mes, ono

Details for d2aywa_

PDB Entry: 2ayw, 0.97 Å

PDB Description: crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2aywa_:

Sequence; same for both SEQRES and ATOM records:

>d2aywa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2aywa_:

• d2aywa_ first appeared in SCOP 1.73, called d2aywa1
  
• d2aywa_ appears in SCOPe 2.07