Lineage for d2aysa_ (2ays A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391520Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1391521Protein Lactoferrin [53889] (6 species)
  7. 1391527Species Cow (Bos taurus) [TaxId:9913] [53891] (10 PDB entries)
  8. 1391528Domain d2aysa_: 2ays A: [127570]
    automated match to d1nkxa_
    complexed with a2g, co3, fe, nag, so4, zn

Details for d2aysa_

PDB Entry: 2ays (more details), 1.86 Å

PDB Description: a conserved non-metallic binding site in the c-terminal lobe of lactoferrin: structure of the complex of c-terminal lobe of bovine lactoferrin with n-acetyl galactosamine at 1.86 a resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d2aysa_:

Sequence, based on SEQRES records: (download)

>d2aysa_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleaca

Sequence, based on observed residues (ATOM records): (download)

>d2aysa_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleaca

SCOPe Domain Coordinates for d2aysa_:

Click to download the PDB-style file with coordinates for d2aysa_.
(The format of our PDB-style files is described here.)

Timeline for d2aysa_: