Lineage for d2ayra1 (2ayr A:307-548)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728502Domain d2ayra1: 2ayr A:307-548 [127569]
    automatically matched to d1qkta_
    complexed with l4g

Details for d2ayra1

PDB Entry: 2ayr (more details), 1.9 Å

PDB Description: a serm designed for the treatment of uterine leiomyoma with unique tissue specificity for uterus and ovaries in rats
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d2ayra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayra1 a.123.1.1 (A:307-548) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemlda
hr

SCOPe Domain Coordinates for d2ayra1:

Click to download the PDB-style file with coordinates for d2ayra1.
(The format of our PDB-style files is described here.)

Timeline for d2ayra1: