Lineage for d2aypa1 (2ayp A:2-269)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874505Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
    CaMK group; CAMKL subfamily; serine/threonine kinase
  7. 874506Species Human (Homo sapiens) [TaxId:9606] [64405] (35 PDB entries)
  8. 874539Domain d2aypa1: 2ayp A:2-269 [127568]
    automatically matched to d1ia8a_
    complexed with 43a

Details for d2aypa1

PDB Entry: 2ayp (more details), 2.9 Å

PDB Description: Crystal Structure of CHK1 with an Indol Inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOP Domain Sequences for d2aypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aypa1 d.144.1.7 (A:2-269) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkpl

SCOP Domain Coordinates for d2aypa1:

Click to download the PDB-style file with coordinates for d2aypa1.
(The format of our PDB-style files is described here.)

Timeline for d2aypa1: