![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cell cycle checkpoint kinase chk1 [64404] (1 species) CaMK group; CAMKL subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64405] (85 PDB entries) |
![]() | Domain d2aypa_: 2ayp A: [127568] automated match to d1ia8a_ complexed with 43a |
PDB Entry: 2ayp (more details), 2.9 Å
SCOPe Domain Sequences for d2aypa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aypa_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal lhkilvenpsaritipdikkdrwynkpl
Timeline for d2aypa_: