Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d2ayob1: 2ayo B:1-76 [127567] Other proteins in same PDB: d2ayoa1 automatically matched to d1aara_ |
PDB Entry: 2ayo (more details), 3.5 Å
SCOPe Domain Sequences for d2ayob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayob1 d.15.1.1 (B:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2ayob1: