![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
![]() | Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142861] (2 PDB entries) Uniprot P54578 100-482 |
![]() | Domain d2ayoa1: 2ayo A:100-482 [127566] Other proteins in same PDB: d2ayob1 automatically matched to 2AYN A:100-482 |
PDB Entry: 2ayo (more details), 3.5 Å
SCOPe Domain Sequences for d2ayoa1:
Sequence, based on SEQRES records: (download)
>d2ayoa1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied dsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfin qevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvn akvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevk yepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtp edilrlsgggdwhiayvllygpr
>d2ayoa1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied dtpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklr lqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplml dmyelctpelqekmvsfrskfkdledevkyepfsfaddigsnncgyydlqavlthqgrss ssghyvswvkrkqdewikfdddkvsivtpedilrlsgggdwhiayvllygpr
Timeline for d2ayoa1: