Lineage for d2aync1 (2ayn C:100-482)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851728Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (5 proteins)
    Pfam PF00443
  6. 851729Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species)
  7. 851730Species Human (Homo sapiens) [TaxId:9606] [142861] (2 PDB entries)
    Uniprot P54578 100-482
  8. 851733Domain d2aync1: 2ayn C:100-482 [127565]
    automatically matched to 2AYN A:100-482

Details for d2aync1

PDB Entry: 2ayn (more details), 3.2 Å

PDB Description: Structure of USP14, a proteasome-associated deubiquitinating enzyme
PDB Compounds: (C:) Ubiquitin carboxyl-terminal hydrolase 14

SCOP Domain Sequences for d2aync1:

Sequence, based on SEQRES records: (download)

>d2aync1 d.3.1.9 (C:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied
dsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfin
qevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvn
akvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevk
yepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtp
edilrlsgggdwhiayvllygpr

Sequence, based on observed residues (ATOM records): (download)

>d2aync1 d.3.1.9 (C:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
melpcgltnlgntcymnatvqcirsvpelkdalkryagalasaqyitaalrdlfdsmdkt
sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddkslid
qffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqspt
lqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelq
ekmvsfrskfkdledepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqde
wikfdddkvsivtpedilrlsgggdwhiayvllygpr

SCOP Domain Coordinates for d2aync1:

Click to download the PDB-style file with coordinates for d2aync1.
(The format of our PDB-style files is described here.)

Timeline for d2aync1: