Lineage for d2ayna1 (2ayn A:100-482)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155260Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species)
  7. 2155261Species Human (Homo sapiens) [TaxId:9606] [142861] (2 PDB entries)
    Uniprot P54578 100-482
  8. 2155262Domain d2ayna1: 2ayn A:100-482 [127563]

Details for d2ayna1

PDB Entry: 2ayn (more details), 3.2 Å

PDB Description: Structure of USP14, a proteasome-associated deubiquitinating enzyme
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d2ayna1:

Sequence, based on SEQRES records: (download)

>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied
dsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfin
qevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvn
akvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevk
yepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtp
edilrlsgggdwhiayvllygpr

Sequence, based on observed residues (ATOM records): (download)

>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
melpcgltnlgntcymnatvqcirsvpelkdalkryagalasaqyitaalrdlfdsmdkt
sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddkslid
qffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqspt
lqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelq
ekmvsfrskfkdledepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqde
wikfdddkvsivtpedilrlsgggdwhiayvllygpr

SCOPe Domain Coordinates for d2ayna1:

Click to download the PDB-style file with coordinates for d2ayna1.
(The format of our PDB-style files is described here.)

Timeline for d2ayna1: