SCOP 1.75: Domain d2aylb2: 2ayl B:1032-1073

Lineage for d2aylb2 (2ayl B:1032-1073)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
   Uniprot P05979 32-584

8. Domain d2aylb2: 2ayl B:1032-1073 [127562]
   Other proteins in same PDB: d2ayla1, d2aylb1
   automatically matched to d1cqeb2
   complexed with bog, flp, gol, man, mnh, nag

Details for d2aylb2

PDB Entry: 2ayl, 2 Å

PDB Description: 2.0 angstrom crystal structure of manganese protoporphyrin ix- reconstituted ovine prostaglandin h2 synthase-1 complexed with flurbiprofen

PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOP Domain Sequences for d2aylb2:

Sequence; same for both SEQRES and ATOM records:

>d2aylb2 g.3.11.1 (B:1032-1073) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d2aylb2:

• d2aylb2 first appeared in SCOP 1.73
  
• d2aylb2 appears in SCOPe 2.01
  
• d2aylb2 appears in the current release, SCOPe 2.08