Lineage for d2ayie1 (2ayi E:3-408)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057854Fold e.60: Thermophilic metalloprotease-like [144051] (1 superfamily)
    consists of two domains; d1: alpha/beta (3 layers, a/b/a; parralel beta-sheet, order 2134); d2: pseudo beta-barrel capped by helices
  4. 1057855Superfamily e.60.1: Thermophilic metalloprotease-like [144052] (1 family) (S)
  5. 1057856Family e.60.1.1: Thermophilic metalloprotease (M29) [144053] (2 proteins)
    Pfam PF02073
  6. 1057860Protein Aminopeptidase T [144054] (1 species)
  7. 1057861Species Thermus thermophilus [TaxId:274] [144055] (1 PDB entry)
    Uniprot P42778 3-408
  8. 1057866Domain d2ayie1: 2ayi E:3-408 [127558]
    automatically matched to 2AYI A:3-408
    complexed with zn

Details for d2ayie1

PDB Entry: 2ayi (more details), 3.7 Å

PDB Description: wild-type ampt from thermus thermophilus
PDB Compounds: (E:) Aminopeptidase T

SCOPe Domain Sequences for d2ayie1:

Sequence, based on SEQRES records: (download)

>d2ayie1 e.60.1.1 (E:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]}
afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatradqe
dpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlc
npnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlr
rlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrpsg
eafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv

Sequence, based on observed residues (ATOM records): (download)

>d2ayie1 e.60.1.1 (E:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]}
afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv

SCOPe Domain Coordinates for d2ayie1:

Click to download the PDB-style file with coordinates for d2ayie1.
(The format of our PDB-style files is described here.)

Timeline for d2ayie1: