![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
![]() | Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries) |
![]() | Domain d2aygb_: 2ayg B: [127553] automated match to d1r8ha_ protein/DNA complex |
PDB Entry: 2ayg (more details), 3.1 Å
SCOPe Domain Sequences for d2aygb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aygb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]} ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee qrqqflnvvkipptirhklgfmsmhll
Timeline for d2aygb_: