SCOPe 2.08: Domain d2aygb_: 2ayg B:

Lineage for d2aygb_ (2ayg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)

8. Domain d2aygb_: 2ayg B: [127553]
   automated match to d1r8ha_
   protein/DNA complex

Details for d2aygb_

PDB Entry: 2ayg, 3.1 Å

PDB Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target

PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d2aygb_:

Sequence; same for both SEQRES and ATOM records:

>d2aygb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

Timeline for d2aygb_:

• d2aygb_ first appeared in SCOP 1.73, called d2aygb1
  
• d2aygb_ appears in SCOPe 2.07