Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries) |
Domain d2ayef_: 2aye F: [127551] automated match to d1r8ha_ complexed with gol, so4 |
PDB Entry: 2aye (more details), 2.3 Å
SCOPe Domain Sequences for d2ayef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayef_ d.58.8.1 (F:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]} satpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhseeq rqqflnvvkipptirhklgfmsmhll
Timeline for d2ayef_: