SCOPe 2.05: Domain d2ayec_: 2aye C:

Lineage for d2ayec_ (2aye C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)

8. Domain d2ayec_: 2aye C: [127548]
   automated match to d1r8ha_
   complexed with gol, so4

Details for d2ayec_

PDB Entry: 2aye, 2.3 Å

PDB Description: crystal structure of the unliganded e2 dna binding domain from hpv6a

PDB Compounds: (C:) Regulatory protein E2

SCOPe Domain Sequences for d2ayec_:

Sequence; same for both SEQRES and ATOM records:

>d2ayec_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

Timeline for d2ayec_:

• d2ayec_ first appeared in SCOP 1.73, called d2ayec1
  
• d2ayec_ appears in SCOPe 2.04
  
• d2ayec_ appears in SCOPe 2.06
  
• d2ayec_ appears in the current release, SCOPe 2.08