Lineage for d2ayea_ (2aye A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)
  8. Domain d2ayea_: 2aye A: [127546]
    automated match to d1r8ha_
    complexed with gol, so4

Details for d2ayea_

PDB Entry: 2aye (more details), 2.3 Å

PDB Description: crystal structure of the unliganded e2 dna binding domain from hpv6a
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2ayea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayea_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
satpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhseeq
rqqflnvvkipptirhklgfmsmhll

SCOPe Domain Coordinates for d2ayea_ are not available.

Timeline for d2ayea_:

Domains from other chains:
(mouse over for more information)
d2ayeb_, d2ayec_, d2ayed_, d2ayee_, d2ayef_