Lineage for d2aybb1 (2ayb B:281-366)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559568Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2559569Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2559579Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2559610Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)
  8. 2559626Domain d2aybb1: 2ayb B:281-366 [127545]
    automatically matched to d1r8ha_
    protein/DNA complex

Details for d2aybb1

PDB Entry: 2ayb (more details), 3.2 Å

PDB Description: crystal structure of hpv6a e2 dna binding domain bound to a 16 base pair dna target
PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d2aybb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aybb1 d.58.8.1 (B:281-366) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

SCOPe Domain Coordinates for d2aybb1:

Click to download the PDB-style file with coordinates for d2aybb1.
(The format of our PDB-style files is described here.)

Timeline for d2aybb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ayba1