SCOP 1.73: Domain d2axzb1: 2axz B:1-69

Lineage for d2axzb1 (2axz B:1-69)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries)

8. Domain d2axzb1: 2axz B:1-69 [127538]
   Other proteins in same PDB: d2axza2, d2axzb2, d2axzc2, d2axzd2
   automatically matched to 2AW6 A:1-69

Details for d2axzb1

PDB Entry: 2axz, 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex

PDB Compounds: (B:) PrgX

SCOP Domain Sequences for d2axzb1:

Sequence; same for both SEQRES and ATOM records:

>d2axzb1 a.35.1.11 (B:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

Timeline for d2axzb1:

• d2axzb1 is new in SCOP 1.73
  
• d2axzb1 appears in SCOP 1.75
  
• d2axzb1 appears in the current release, SCOPe 2.08