![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) ![]() |
![]() | Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
![]() | Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
![]() | Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries) |
![]() | Domain d2axza1: 2axz A:1-69 [127536] Other proteins in same PDB: d2axza2, d2axzb2, d2axzc2, d2axzd2 automatically matched to 2AW6 A:1-69 |
PDB Entry: 2axz (more details), 3 Å
SCOP Domain Sequences for d2axza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axza1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]} mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe ilnragmnt
Timeline for d2axza1: