Lineage for d2axyd_ (2axy D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947135Protein Poly(RC)-binding protein 2 [143220] (1 species)
    contains three KH domains
  7. 2947136Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries)
    Uniprot Q15366 11-81
  8. 2947140Domain d2axyd_: 2axy D: [127535]
    Other proteins in same PDB: d2axya2, d2axyc3
    automated match to d2axya1
    protein/DNA complex

Details for d2axyd_

PDB Entry: 2axy (more details), 1.7 Å

PDB Description: Crystal Structure of KH1 domain of human Poly(C)-binding protein-2 with C-rich strand of human telomeric DNA
PDB Compounds: (D:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2axyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axyd_ d.51.1.1 (D:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
famiidkleed

SCOPe Domain Coordinates for d2axyd_:

Click to download the PDB-style file with coordinates for d2axyd_.
(The format of our PDB-style files is described here.)

Timeline for d2axyd_: