Lineage for d2axyc1 (2axy C:11-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722630Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 722631Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 722632Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (13 proteins)
    an RNA-binding domain
  6. 722674Protein Poly(RC)-binding protein 2 [143220] (1 species)
    contains three KH domains
  7. 722675Species Human (Homo sapiens) [TaxId:9606] [143221] (3 PDB entries)
  8. 722678Domain d2axyc1: 2axy C:11-81 [127534]
    automatically matched to 2AXY A:11-81

Details for d2axyc1

PDB Entry: 2axy (more details), 1.7 Å

PDB Description: Crystal Structure of KH1 domain of human Poly(C)-binding protein-2 with C-rich strand of human telomeric DNA
PDB Compounds: (C:) Poly(rC)-binding protein 2

SCOP Domain Sequences for d2axyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axyc1 d.51.1.1 (C:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
nvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifk
afamiidklee

SCOP Domain Coordinates for d2axyc1:

Click to download the PDB-style file with coordinates for d2axyc1.
(The format of our PDB-style files is described here.)

Timeline for d2axyc1: