SCOPe 2.05: Domain d2axyb_: 2axy B:

Lineage for d2axyb_ (2axy B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
   an RNA-binding domain

6. Protein Poly(RC)-binding protein 2 [143220] (1 species)
   contains three KH domains

7. Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries)
   Uniprot Q15366 11-81

8. Domain d2axyb_: 2axy B: [127533]
   automated match to d2axya1
   protein/DNA complex

Details for d2axyb_

PDB Entry: 2axy, 1.7 Å

PDB Description: Crystal Structure of KH1 domain of human Poly(C)-binding protein-2 with C-rich strand of human telomeric DNA

PDB Compounds: (B:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2axyb_:

Sequence; same for both SEQRES and ATOM records:

>d2axyb_ d.51.1.1 (B:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
famiidkleed

Timeline for d2axyb_:

• d2axyb_ first appeared in SCOP 1.73, called d2axyb1
  
• d2axyb_ appears in SCOPe 2.04
  
• d2axyb_ appears in SCOPe 2.06
  
• d2axyb_ appears in the current release, SCOPe 2.08