Lineage for d2axvc1 (2axv C:2-66)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709830Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 2709844Domain d2axvc1: 2axv C:2-66 [127528]
    Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
    automated match to d2awia1
    mutant

Details for d2axvc1

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2axvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axvc1 a.35.1.0 (C:2-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

SCOPe Domain Coordinates for d2axvc1:

Click to download the PDB-style file with coordinates for d2axvc1.
(The format of our PDB-style files is described here.)

Timeline for d2axvc1: