Lineage for d2axvb2 (2axv B:67-304)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746069Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1746199Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 1746228Protein automated matches [254479] (1 species)
    not a true protein
  7. 1746229Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. 1746242Domain d2axvb2: 2axv B:67-304 [127527]
    Other proteins in same PDB: d2axva1, d2axvb1, d2axvc1, d2axvd1
    automated match to d2awia2
    mutant

Details for d2axvb2

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axvb2 a.118.8.4 (B:67-304) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva

SCOPe Domain Coordinates for d2axvb2:

Click to download the PDB-style file with coordinates for d2axvb2.
(The format of our PDB-style files is described here.)

Timeline for d2axvb2: