![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
![]() | Protein automated matches [254479] (1 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries) |
![]() | Domain d2axvb2: 2axv B:67-304 [127527] Other proteins in same PDB: d2axva1, d2axvb1, d2axvc1, d2axvd1 automated match to d2awia2 mutant |
PDB Entry: 2axv (more details), 3 Å
SCOPe Domain Sequences for d2axvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axvb2 a.118.8.4 (B:67-304) automated matches {Enterococcus faecalis [TaxId: 1351]} mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie vptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdy dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva
Timeline for d2axvb2: