Lineage for d2axva1 (2axv A:2-66)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640518Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 640519Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 640520Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries)
  8. 640555Domain d2axva1: 2axv A:2-66 [127524]
    Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
    automatically matched to 2AWI A:2-66
    mutant

Details for d2axva1

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (A:) PrgX

SCOP Domain Sequences for d2axva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axva1 a.35.1.11 (A:2-66) PrgX {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

SCOP Domain Coordinates for d2axva1:

Click to download the PDB-style file with coordinates for d2axva1.
(The format of our PDB-style files is described here.)

Timeline for d2axva1: