SCOP 1.73: Domain d2axva1: 2axv A:2-66

Lineage for d2axva1 (2axv A:2-66)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries)

8. Domain d2axva1: 2axv A:2-66 [127524]
   Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
   automatically matched to 2AWI A:2-66
   mutant

Details for d2axva1

PDB Entry: 2axv, 3 Å

PDB Description: structure of prgx y153c mutant

PDB Compounds: (A:) PrgX

SCOP Domain Sequences for d2axva1:

Sequence; same for both SEQRES and ATOM records:

>d2axva1 a.35.1.11 (A:2-66) PrgX {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

Timeline for d2axva1:

• d2axva1 is new in SCOP 1.73
  
• d2axva1 appears in SCOP 1.75
  
• d2axva1 appears in the current release, SCOPe 2.08