Lineage for d2axul2 (2axu L:71-302)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501447Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1501577Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 1501578Protein PrgX [140849] (1 species)
  7. 1501579Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 1501603Domain d2axul2: 2axu L:71-302 [127523]
    Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
    automated match to d2aw6a2

Details for d2axul2

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (L:) PrgX

SCOPe Domain Sequences for d2axul2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axul2 a.118.8.4 (L:71-302) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny

SCOPe Domain Coordinates for d2axul2:

Click to download the PDB-style file with coordinates for d2axul2.
(The format of our PDB-style files is described here.)

Timeline for d2axul2: