Lineage for d2axuj2 (2axu J:71-301)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339910Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2339911Protein PrgX [140849] (1 species)
  7. 2339912Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 2339934Domain d2axuj2: 2axu J:71-301 [127519]
    Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
    automated match to d2aw6a2

Details for d2axuj2

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (J:) PrgX

SCOPe Domain Sequences for d2axuj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axuj2 a.118.8.4 (J:71-301) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen

SCOPe Domain Coordinates for d2axuj2:

Click to download the PDB-style file with coordinates for d2axuj2.
(The format of our PDB-style files is described here.)

Timeline for d2axuj2: