Lineage for d2axuj1 (2axu J:4-68)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733130Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1733131Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1733132Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1733154Domain d2axuj1: 2axu J:4-68 [127518]
    Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2
    automated match to d2aw6a1

Details for d2axuj1

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (J:) PrgX

SCOPe Domain Sequences for d2axuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axuj1 a.35.1.11 (J:4-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
ragmn

SCOPe Domain Coordinates for d2axuj1:

Click to download the PDB-style file with coordinates for d2axuj1.
(The format of our PDB-style files is described here.)

Timeline for d2axuj1: