![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) ![]() |
![]() | Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
![]() | Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
![]() | Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries) |
![]() | Domain d2axuj1: 2axu J:4-68 [127518] Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2 automatically matched to 2AW6 A:1-69 |
PDB Entry: 2axu (more details), 2.9 Å
SCOP Domain Sequences for d2axuj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axuj1 a.35.1.11 (J:4-68) PrgX {Enterococcus faecalis [TaxId: 1351]} igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln ragmn
Timeline for d2axuj1: