Lineage for d2axui1 (2axu I:2-68)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640518Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 640519Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 640520Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries)
  8. 640541Domain d2axui1: 2axu I:2-68 [127516]
    Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2
    automatically matched to 2AW6 A:1-69

Details for d2axui1

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (I:) PrgX

SCOP Domain Sequences for d2axui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axui1 a.35.1.11 (I:2-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnragmn

SCOP Domain Coordinates for d2axui1:

Click to download the PDB-style file with coordinates for d2axui1.
(The format of our PDB-style files is described here.)

Timeline for d2axui1: