SCOPe 2.05: Domain d2axue2: 2axu E:71-304

Lineage for d2axue2 (2axu E:71-304)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein PrgX [140849] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
   Uniprot Q04114 70-287! Uniprot Q04114 71-301

8. Domain d2axue2: 2axu E:71-304 [127509]
   Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
   automated match to d2aw6a2

Details for d2axue2

PDB Entry: 2axu, 2.9 Å

PDB Description: Structure of PrgX

PDB Compounds: (E:) PrgX

SCOPe Domain Sequences for d2axue2:

Sequence; same for both SEQRES and ATOM records:

>d2axue2 a.118.8.4 (E:71-304) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva

Timeline for d2axue2:

• d2axue2 first appeared in SCOP 1.73
  
• d2axue2 appears in SCOPe 2.04
  
• d2axue2 appears in SCOPe 2.06
  
• d2axue2 appears in the current release, SCOPe 2.08