Lineage for d2axub1 (2axu B:2-68)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268438Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1268439Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1268440Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1268454Domain d2axub1: 2axu B:2-68 [127502]
    Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2
    automated match to d2aw6a1

Details for d2axub1

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axub1 a.35.1.11 (B:2-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnragmn

SCOPe Domain Coordinates for d2axub1:

Click to download the PDB-style file with coordinates for d2axub1.
(The format of our PDB-style files is described here.)

Timeline for d2axub1: