Lineage for d2axpb1 (2axp B:2-165)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695284Protein Hypothetical protein YorR [142211] (1 species)
  7. 695285Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry)
  8. 695287Domain d2axpb1: 2axp B:2-165 [127498]
    automatically matched to 2AXP A:2-165

Details for d2axpb1

PDB Entry: 2axp (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein BSU20280 from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR256.
PDB Compounds: (B:) hypothetical protein BSU20280

SCOP Domain Sequences for d2axpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axpb1 c.37.1.1 (B:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve

SCOP Domain Coordinates for d2axpb1:

Click to download the PDB-style file with coordinates for d2axpb1.
(The format of our PDB-style files is described here.)

Timeline for d2axpb1: