Lineage for d2axpb2 (2axp B:2-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866044Protein Hypothetical protein YorR [142211] (1 species)
  7. 2866045Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry)
    Uniprot O31896 2-165
  8. 2866047Domain d2axpb2: 2axp B:2-167 [127498]
    Other proteins in same PDB: d2axpa2, d2axpb3
    automated match to d2axpa1

Details for d2axpb2

PDB Entry: 2axp (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein BSU20280 from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR256.
PDB Compounds: (B:) hypothetical protein BSU20280

SCOPe Domain Sequences for d2axpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axpb2 c.37.1.1 (B:2-167) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvele

SCOPe Domain Coordinates for d2axpb2:

Click to download the PDB-style file with coordinates for d2axpb2.
(The format of our PDB-style files is described here.)

Timeline for d2axpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axpb3