Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Hypothetical protein YorR [142211] (1 species) |
Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry) Uniprot O31896 2-165 |
Domain d2axpa1: 2axp A:2-165 [127497] |
PDB Entry: 2axp (more details), 2.5 Å
SCOPe Domain Sequences for d2axpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve
Timeline for d2axpa1: