SCOPe 2.01: Domain d2axpa1: 2axp A:2-165

Lineage for d2axpa1 (2axp A:2-165)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Hypothetical protein YorR [142211] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry)
   Uniprot O31896 2-165

8. Domain d2axpa1: 2axp A:2-165 [127497]

Details for d2axpa1

PDB Entry: 2axp, 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein BSU20280 from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR256.

PDB Compounds: (A:) hypothetical protein BSU20280

SCOPe Domain Sequences for d2axpa1:

Sequence; same for both SEQRES and ATOM records:

>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve

Timeline for d2axpa1:

• d2axpa1 first appeared in SCOP 1.73
  
• d2axpa1 appears in SCOP 1.75
  
• d2axpa1 appears in SCOPe 2.02
  
• d2axpa1 appears in the current release, SCOPe 2.08