![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Hypothetical protein YorR [142211] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry) |
![]() | Domain d2axpa1: 2axp A:2-165 [127497] |
PDB Entry: 2axp (more details), 2.5 Å
SCOP Domain Sequences for d2axpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve
Timeline for d2axpa1: