Lineage for d2axoa1 (2axo A:38-262)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486798Family c.47.1.19: Atu2684-like [142398] (1 protein)
    Pfam PF06764; DUF1223; contains extra C-terminal domain of Immunoglobulin-like fold (48725), intimately associated with the N-terminal thioredixin-like domain and contributing to the active site
  6. 2486799Protein Hypothetical protein Atu2684 [142399] (1 species)
  7. 2486800Species Agrobacterium tumefaciens [TaxId:358] [142400] (1 PDB entry)
    Uniprot Q8UC14 38-262
  8. 2486801Domain d2axoa1: 2axo A:38-262 [127496]
    Other proteins in same PDB: d2axoa2

Details for d2axoa1

PDB Entry: 2axo (more details), 1.8 Å

PDB Description: X-Ray Crystal Structure of Protein AGR_C_4864 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR35.
PDB Compounds: (A:) hypothetical protein Atu2684

SCOPe Domain Sequences for d2axoa1:

Sequence, based on SEQRES records: (download)

>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]}
aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken
terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa
gdeveidigagngkadvvvayftreqtvdvqkgenqgkkmsywhsvydvqtvgmwdgspm
tvklpasvvakvkkggcavllqtanasgdpaaivgasillgnetq

Sequence, based on observed residues (ATOM records): (download)

>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]}
aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken
terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa
gdeveidigagngkadvvvayftreqtvdvkkmsywhsvydvqtvgmwdgspmtvklpas
vvakvkkggcavllqtanasgdpaaivgasillgnetq

SCOPe Domain Coordinates for d2axoa1:

Click to download the PDB-style file with coordinates for d2axoa1.
(The format of our PDB-style files is described here.)

Timeline for d2axoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axoa2