![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.19: Atu2684-like [142398] (1 protein) Pfam PF06764; DUF1223; contains extra C-terminal domain of Immunoglobulin-like fold (scop_cf 48725), intimately associated with the N-terminal thioredixin-like domain and contributing to the active site |
![]() | Protein Hypothetical protein Atu2684 [142399] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [142400] (1 PDB entry) |
![]() | Domain d2axoa1: 2axo A:38-262 [127496] |
PDB Entry: 2axo (more details), 1.8 Å
SCOP Domain Sequences for d2axoa1:
Sequence, based on SEQRES records: (download)
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa gdeveidigagngkadvvvayftreqtvdvqkgenqgkkmsywhsvydvqtvgmwdgspm tvklpasvvakvkkggcavllqtanasgdpaaivgasillgnetq
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa gdeveidigagngkadvvvayftreqtvdvkkmsywhsvydvqtvgmwdgspmtvklpas vvakvkkggcavllqtanasgdpaaivgasillgnetq
Timeline for d2axoa1: